SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084309 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084309
Domain Number 1 Region: 184-310
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-37
Family Pleckstrin-homology domain (PH domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 440-542
Classification Level Classification E-value
Superfamily SH2 domain 1.16e-24
Family SH2 domain 0.0000392
Further Details:      
 
Domain Number 3 Region: 67-128
Classification Level Classification E-value
Superfamily Phenylalanine zipper 1.83e-19
Family Adapter protein APS, dimerisation domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084309   Gene: FBgn0028717   Transcript: FBtr0084935
Sequence length 723
Comment pep:known chromosome:BDGP5:3R:21714265:21718999:1 gene:FBgn0028717 transcript:FBtr0084935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGNSTGANTSAFSAGGYIGPTSASSHHSLGTSSAAAAAAAGSDLIPAPIGTGNAMGVSS
YAYGGTSWEEFCERHARVAASDFAKACITYINGNLPPEEARNIQHRSFAQKFVESFSAHY
DTEFFKRRSTLKSGAGSLDFEEEHEVPKLLSKSLLRRLSFKGLRKGKAFFHKNSDDLDGS
GGSGKQSKTKLAKIVVECRKEGTVNNLTPESLDQPTGSQKWEKCRLVLVKAVGGYMLEFY
TPHKATKPRSGVFCFLISEARETTALEMPDRLNTFVLKADNNMEYVIEAESAEEMRSWLA
TIRYCMRTPPTQQPTIESDGVMASAMQTSPTLPSPNPIGGIQNPQYQQQRGSNGNLVGGG
APLTSSLSADSALGQGGATSASELNVINELGTSPTSGPPDIPVRPHRGEQRLSASSNFDG
IEGTENDADVADLTAEMSVFPWFHGTLTRSEAARMVLHSDAAGHGYFLVRQSETRRGEFV
LTFNFQGRAKHLRLTISEKGQCRVQHLWFPSIQEMLEHFRHNPIPLESGGTSDVTLTEWV
HSHSRLNDPTTAANHDSGQLNDLSTNGNGNGNGNGYDNGQGSSTASNAAGGTASGAAGGG
HPSPRHCNEVITMNLSVRLKTNEIELPQEPTHVYFPEQVYFHLDPTTLTVHGSPPPAQNF
LDQPHLRASNASLQAAAHHQAGSSGNRHPSDGGSNSGGAGGGSGSSGGAECTGRAVDNQY
SFT
Download sequence
Identical sequences Q7K137
FBpp0084309 FBpp0084309 FBpp0084310 FBpp0084311 NP_651438.1.81976 NP_733125.1.81976 NP_733126.1.81976 FBpp0084309 FBpp0084310 FBpp0084311 7227.FBpp0084311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]