SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084763 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084763
Domain Number 1 Region: 707-827
Classification Level Classification E-value
Superfamily Bromodomain 1.31e-17
Family Bromodomain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084763   Gene: FBgn0039654   Transcript: FBtr0085394
Sequence length 872
Comment pep:known chromosome:BDGP5:3R:25049213:25051998:1 gene:FBgn0039654 transcript:FBtr0085394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGVQERLQLSRMPLDTWSKREQLILASAVSCSGDQNWITVSRTLKTICGNGSSNRPAD
WFSQKNCAMQYGNLLESVEATKRKKRSSESSAGVSSPATVETPTELLLRRLTEERQAEIK
AQMRQDQETYRRIQREIESLQSDAVTEQELQDMWLEIEKEQEARRIEEMKLENRMREREQ
RKKDLASNWRNSSLAVKRSNQAADTTSVDMDVEDINTSGNGKQQTGPSPLLTSLLKSPTG
NAPATPTPGGAAPAAGGTGSVARATAPTITSLLTSGPSSAVANQPVITMKSPTDAAFMSR
PITGPPASEASTTPTLERSPSQAAPTLSMLLEKNMAAAKANESGSLVKPEGSGNQEQGVD
EATSSAAGTADSDEADPNEAQLLEVFKNIDQIIDDIDIDMASVIDDEILKNVDDVVASPS
NDKAEVIDFEDKLDALKREQSKSSPASDKPKSVELVIGSSDDSNDNIPLAAVASQESKDR
GQSGGESTRGTEDAESEPLTSEVAVEEIGETITIISTSSEDTAGSPPTKMEEDGATDSLP
KKEDAAEDKSEQESSSQGQNKAGGSTDEPELIDHQATREAQSKSGKDTAGKPVTMQEKTT
TQSAPVPVDLHDTDEESSSLTDSSKHDDHPRSAKAKPPALKLALDDSKSELELSGTPQPP
SAPARTPLLRKLPHRDRSESPMVDDDATTASDHSTARSTRRRCSSTPVIDSIPNSPASSE
HTDDRRETRAASKKLFLSIYAMLLDSKHAAPFKRPFHDEHAQRHADLCLRPMDFPTIKRN
IDSGFIRSLSELHRDVLLMAHNVLVAYKPHTAQHKTARLFVQDCQAIKEFSQLPDVQAGI
TATPVSNTGSLRADKSSGSKARSGSRKSQRHH
Download sequence
Identical sequences Q9VAM5
7227.FBpp0084763 NP_651685.2.81976 FBpp0084763 FBpp0084763 FBpp0084763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]