SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085204 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085204
Domain Number 1 Region: 1344-1460
Classification Level Classification E-value
Superfamily Bromodomain 1.57e-31
Family Bromodomain 0.00013
Further Details:      
 
Domain Number 2 Region: 1050-1112
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000782
Family PHD domain 0.0016
Further Details:      
 
Domain Number 3 Region: 1230-1293
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000421
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085204   Gene: FBgn0027620   Transcript: FBtr0085845
Sequence length 1476
Comment pep:known chromosome:BDGP5:3R:27619811:27625533:1 gene:FBgn0027620 transcript:FBtr0085845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPICKREGFDLNQKEGKNETFHDNDQVFCCYITKRIFRDYEHYFRHVMVINSTVWQCEAT
GKENLTYEEAVKSERAARKKMEQFKQSLRAPVLLVVEHAQQSAVNTLNMIVAKFLRKRYF
IGEEVSVQAKKNATYTVLGVKLDKNMPEPLNGIYEDTDNLVYRLRPNKGDPSAELDLPFR
QLRRSRMEFNLENLSMFIKSNVSRVDGLLRPKPEAYKQYVTDPGVNFSTIFIGKMPRYSP
AKIKKPDGKKQSTLNKYIVAGEATAAKSKAKAKSDAKSLAEELERVKREKEAKLIELEKQ
KAEKKAQLIERVENECNLLLQKTDDLERTDQKVLPRYRQIVTLLPEHLLGDAFMMREFMH
TYTGLLSGIEVFRQNLSFYEMTRALTAREIAGPLSDILLVLLGTVFDLQKEEEEECAVTY
LDRAAQTQEPYWSMAQAAKSHLYAKRHFSFKVNELPLDALTLSEVLRLHLLGSGAFVNEK
AERWRVMYRNGYSSKEDPGLELRLEHSHILRILKNHSVYQLKFKDIMLLIRCLMSQIMTY
SGTINLIEERMEQTAKARQDLRALVVGENKRLAAVEINRKKLTQMHHLEVNGVEPEKREA
LVEKLKKSIAELHAQSDQQHRKHELQMLKLHSQLFNFLVYLGMDRCYRKYYVLESMPGIF
VEHSPDSLDTCLEQPITNKSQIEIRQQSALPKNRKDLRVYLLKLYGDDEKKTKKKAKHSL
ENKENQEHRLNGSAEPMDVESDSPEAPTHFELLMCSGDKRSCIVHDSRNGQRQRWAYIYK
AEEIDELIKALNPNGLREYELLQELSVLRSLIEQHAKTCPVDLLSLENETMRKKFMAAME
SETNRKYGEANFGLPNGTDLNEVMRLHLVDRIIQFENDIYTGDLGRLKVKDMEKWRSDLL
GGNYDAQCKLQWGPGGKLEDEAGSDNESHETHEEDDGALLGKYARKPYRDPGMYLAASAD
TKPLPDSDDEEDQHTNAVSIPIAVHNMASALLQVEQAIGKRFLKEPYGMKKWDPKQEALK
LACDSRLHQWEVSLMESTSFAQVFLHLNILHDCIQWRRSTNKSLCKVCRRGSDPEKMLLC
DECNAGTHMFCLKPKLRSVPPGNWYCNDCVKSLGLSNGQNEKDKKQATKKKRKFIVEEED
DEATDEEEEEKKDDDMTDEDAEHENEKHDEDVEDDESVTSTPSSSRVNGRILRRPRTRPT
SRRLTSKEIEEHAQEDVDSGDVSDDASLTAGEDTIEDESDEEKVCQKCFYDGGEIKCVQC
RLFFHLECVHLKRPPRTDFVCKTCKPMPQRPRRRHSNMNGDHDRDEEEPKAKRPRNSLRL
SIDKTARPSNGNNNNNNNNSSVNNNNHRRSGRRTNEHMPLNSAALYDLLEQIMKHKAAWP
FLRPVLTSEVPDYHQIIKTPMDLAKIKSKLNMGAYQLNEELLSDIQLVFRNCDLYNVEGN
EIYDAGCQLERFVIDRCRDMQLPFRPSDMNGEVKAC
Download sequence
Identical sequences Q9V9T4
FBpp0085204 NP_536734.2.81976 7227.FBpp0085204 FBpp0085204 FBpp0085204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]