SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085756 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085756
Domain Number 1 Region: 1252-1517
Classification Level Classification E-value
Superfamily NHL repeat 1.23e-49
Family NHL repeat 0.0000134
Further Details:      
 
Domain Number 2 Region: 5-81
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000381
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085756   Gene: FBgn0034412   Transcript: FBtr0086572
Sequence length 1517
Comment pep:known chromosome:BDGP5:2R:14874846:14896449:1 gene:FBgn0034412 transcript:FBtr0086572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQFEQLLTCCVCLDRYRIPKLLPCQHSFCMEPCMEGLVDYVRRQVKCPECRAEHRIPYN
GVQAFPTNVTLQRFLELHIEITGELPDPTSGQIMERCGVCSEKAYLSHCAHCEKKICEDC
KSAHMDILRREITRFNSQIRRSLHRLQDSLAIIEKNTMSLQTNAISVTEEIDEIYQRITK
AIKDRSDQLKGEIDRYLAVELRNLTTLKENLDLEITNITSNCDTVDKYMNETVEWDDCEL
MDTKEIFLKTVEFLRHFEYENNDYSRRVRFLVSIDPNQLVMNLATFGDLNIAPHSTPSGG
SVSSSHLAPPSALQPGLMRSKSDHRLATQFRQQEERSGYNDEPVLGGRKFGERPQRSATQ
ANNDRYGRSGGDYDYENDYDNEGSSGRAGKSSRFRSRFVRSHQNDDSDSEQQQQQRQQEL
KERKDRVLDSEDVSRGQLSGIIRLSDCSRVVQRLADIGKEKKEKKSDAAAAAQAAVQAAI
QAQKAAMQRQQQKNQQNAADEEELARQKRKNAGSSSTGGAATSTSSGGGDTASDQRVAAL
KNRGGEESDGSSNQAASPVRNSAASTTRAEVSVNEANTEEEGVASESSDSEEDEEVEDED
EEEEVDEEEEQVEESVEEEEAPRELLNLPEEALQPTSSEVTEEEESSSEYEEVTATESEE
EQEEVEGRVIEIESQDLPVINVLPPENDIAHKVEESPVDHISNQELMEETDKSTDESPEE
EEEEEYTEEEIESKPPVSAQVAAVKKTQRSGSSDSSASTESSASSAAAAAVAATSTSATA
AAPATSSSNSTSQNAKAPSSSRYSTARDTTAVPEKKPFVSRFLPQHSTASTTNGSADKKK
AESSSSSEEETSSESESESEPETKAKSSATSSTTNTKSTPNSAASSTTAASSSTTSGSYR
DRLEARRASRDDSSSTAAGRSSYATPSSSGYGSGSGTTGGRTRAVPAPHHTSESEDRYGS
GTGSSYTSRFLNKSKSSAIVTQPSLSTPTASFDEDATGTGDDSDSRYGTGRSRYLAMKER
RTRLARSRSSHQFGNDDEDLDEPVSPTTVSPSAYLASRCAYSGYGSSDLSRSRSSHALKS
RDNSPITDRGAGSSRSSGLGGSSTTDSKDGEALSSWARYLKNKYGNKSSKDSAGSSGSAR
DTHAGSSTSSSAAASSSHAHGYGSGTSGSSGRSTASDVSRRLSLGLPLRQANELASSDDD
GSKNGLGSPTSPTVAAAVAAAGITGAAGTIPKQVYLRKRQQLFQLGGRGSEPGSFTWPRG
LAVGPDNSIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDCLAGVAVNRIGQYIIAD
RYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTDALGFIYVCDKENHRVQVFQSDG
SFVGKFGSCGRGEGQLEHPHYIAVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDD
GQFKFPRGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMS
NGNILVCDRENHRVQVF
Download sequence
Identical sequences B7YZK8
FBpp0085756 FBpp0113114 NP_001137707.1.81976 7227.FBpp0113114 FBpp0113114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]