SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085777 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085777
Domain Number 1 Region: 352-645
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.41e-85
Family beta-glycanases 0.0000000908
Further Details:      
 
Domain Number 2 Region: 47-236
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.46e-55
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00000545
Further Details:      
 
Domain Number 3 Region: 238-349
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 2.33e-19
Family beta-Galactosidase/glucuronidase domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085777   Gene: FBgn0034417   Transcript: FBtr0086593
Sequence length 670
Comment pep:known chromosome:BDGP5:2R:15009735:15016746:-1 gene:FBgn0034417 transcript:FBtr0086593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLRIRLTCRKYEIWALSIFSLVTGLYVLHFSIALILVNKEVPQTRGMLYPRESETREVR
SLDGIWNFVRSDQANPTQGVRDEWYAKELSKSRPTIPMPVPASYNDITTDNLRDHVGTVW
YDRKFFVPRSWSKDQRIWLRFGSVHYEAYVWINGQKVVKHEMGHLPFEAEVTDLLSYGAE
NRITVMCDNALIQTTVPQGRITEVPNDGGMTIVQSYTFDFFNYAGIHRSVHLYTTPRTFI
EEVEVTTNLSKDATVGEVFYSVSVNGSAANEADNVLQIQANLYDKDGILVANATSDQKLG
GKLQVNPVKPWWPYLMHSEPGYLYQLEIKLLATNDELLDVYRLKVGIRTLSWNSQQFLIN
GKPVYFRGFGRHEDSDIRGKGLDNALMVRDFNLLKWIGANAYRTSHYPYSEESMQFADEH
GIMIIDECPSVDTENFSQELLGKHKSSLEQLIHRDRNHPSVVMWSIANEPRTGSVSADSY
FELVANFTRSLDKTRPITAAIAVSNTQDKAGRSLDIISFNRYNAWYSNAGRLDMITQNVI
DEAIAWNKRYNKPIIMSEYGADTLEGLHMQPAYVWSEEFQTEVFSRHFKAFDELRKKGWF
IGEFVWNFADFKTAQSYTRVGGNKKGVFTRARQPKAAAHLLRKRYFALGRDLDQCSFPED
LFTYIADLIS
Download sequence
Identical sequences A1ZBG9
7227.FBpp0085778 FBpp0085778 NP_725851.1.81976 FBpp0085778 FBpp0085777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]