SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085914 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085914
Domain Number 1 Region: 502-580
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000532
Family PHD domain 0.009
Further Details:      
 
Domain Number 2 Region: 417-474
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000123
Family PHD domain 0.028
Further Details:      
 
Weak hits

Sequence:  FBpp0085914
Domain Number - Region: 355-399
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000191
Family Tudor domain 0.015
Further Details:      
 
Domain Number - Region: 331-340,500-507
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0123
Family Formin homology 2 domain (FH2 domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085914   Gene: FBgn0003044   Transcript: FBtr0086735
Sequence length 1043
Comment pep:known chromosome:BDGP5:2R:14022934:14026947:1 gene:FBgn0003044 transcript:FBtr0086735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNNHFHLQHDHPPQNVAHPFMQQPSTAVPSAPPATYGYLAQPAGQQPQWMTTTYQILPP
SVGPATVAKRYYATTGPQTTHPTHPSTIQITNSFAQQSTPPKQQAATSCSPFKANNIRII
STAPSVYSLNKPPQEAHSTYAPVQSYYLPSGGGQTAGQINLLAASGTGKQLQPPPLVPVT
NSTSPPSTVVLDRINICINNHYTETPTSLSSSLTTAQQPSPIIPAIQHKAILPLIDSSTA
DSSSCSSSSVSSSSYSGTATTSAAVVIVDEPDSTTTTPQTPPTTPEAMSSPGKSSPSPPL
LATQSLLKGVNSMKPSFKTVEAAPPTPPTPPSPPPPPPAPPVAAPSPAVTYALQEDVFIK
CNDGRFYLGTIIDQTSDQYLIRFDDQSEQWCEPDKLRKLGGGSSITAGGGGASTTESTNT
SPSGPMCVACKRSDIEDVVEICERCGRGYHRGCTVEIVTGSGIWSCKRCAKPMKMQQPVS
HKITKPAGICRQLPYHADKLSWDEKHRVNEEQIYCYCGKPGKFDHNMLQCCKCRNWFHTQ
CMQNFKKKLLRGDMFFVFCCTVCNNGIEFVRRMQIEWVDVLHIALYNLRKHQHQKYHHLL
NDIWPFILEQRHQLPICEKWRTLPETALMERLKQTLKDYSDRFVCGREFKRAPAFYALRH
SGPPHIPKVFLEPHEELSDELLEKRFKLMLMPEEPDEGANELPKRVPKDVYEFNTDEDDP
VETSEDEIPIKQIIEKAKKQAAQKADKHDELPLKPDLADDNANDGDPGKLPAPIPPLLDA
NSSRKRKAFRLSKRYDNSRNHCDLSSDENSSSSRGTSSLDLIIPPPVNFLGRNNPFLMAT
PKKASQGRSISVGTGVGVNGIINSIFKLKGTSKEQPRMVRTIKRRLSAKDITIGPNQEVR
RRRTRRLTTAIEVISTTTINPIPSHYLPIYAKDLQPPAPPMGKPTHGRLLRQRPQKQSPS
QSRRNSTSSTATSSSSNGIGAPGHSMLDLKQSVNKYFGGAMNRIDAGEPFAIRAKRRMGN
GQVQYLVEWGGDTATTAIGLLGN
Download sequence
Identical sequences A0A0B4KEZ1 Q24459
FBpp0085914 FBpp0303033 NP_001261067.1.81976 NP_476672.1.81976 FBpp0085914 FBpp0085914 7227.FBpp0085914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]