SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086720 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086720
Domain Number 1 Region: 60-191,240-341
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.04e-56
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000757
Further Details:      
 
Domain Number 2 Region: 350-453
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.35e-27
Family Anticodon-binding domain of PheRS 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086720   Gene: FBgn0020766   Transcript: FBtr0087594
Sequence length 453
Comment pep:known chromosome:BDGP5:2R:9855852:9857407:1 gene:FBgn0020766 transcript:FBtr0087594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTLRVQGARHWLKSTRCLASSAAPAKSPSSPPQLEVSGSTYATDGWTNVTPKILSYVG
ANKHLQTDHPLSIIRQRIVNYFYGAYRNQRGNPLFSVYDQMNPVVTVQQNFDNLLIPADH
VSRQKSDCYYINQQHLLRAHTTAHQVELISGGLDNFLVVGEVYRRDEIDSTHYPVFHQAD
AVRLVTKDKLFERNPGLELFEETWSGTLADPKLILPSSKFMDQTKQPCHTLEAVKLMEHE
MKHVLVGLTKDLFGPRIKYRWVDTYFPFTQPSWELEIYFKDNWLEVLGCGIMRHEILQRS
GVHQSIGYAFGVGLERLAMVLFDIPDIRLFWSNDSGFLSQFSEKDLHNLPKYKPISHYPQ
CTNDLSFWLPQDIEVDAGFSPNDFYDLVRSVAGDMVEQISLVDKFKHPKTGKSSVCFRIV
YRHMERTLTQAEVNEIHKQIASASVDSFNVQIR
Download sequence
Identical sequences O16129
FBpp0086720 FBpp0086720 7227.FBpp0086720 NP_477283.1.81976 FBpp0086720 7303248___KOG2783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]