SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087651 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087651
Domain Number 1 Region: 41-101
Classification Level Classification E-value
Superfamily SAP domain 0.00000000000000897
Family SAP domain 0.0028
Further Details:      
 
Weak hits

Sequence:  FBpp0087651
Domain Number - Region: 366-433
Classification Level Classification E-value
Superfamily RING/U-box 0.00757
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087651   Gene: FBgn0003612   Transcript: FBtr0088570
Sequence length 640
Comment pep:known chromosome:BDGP5:2R:5003631:5008321:1 gene:FBgn0003612 transcript:FBtr0088570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKTRSQTARTQAENAATSSSPGHQSTSSAPIAVNPFDSTKYKECEQMVQMLRVVELQKI
LSFLNISFAGRKTDLQSRILSFLRTNLELLAPKVQEVYAQSVQEQNATLQYIDPTRMYSH
IQLPPTVQPNPVGLVGSGQGVQVPGGQMNVVGGAPFLHTHSINSQLPIHPDVRLKKLAFY
DVLGTLIKPSTLVPRNTQRVQEVPFYFTLTPQQATEIASNRDIRNSSKVEHAIQVQLRFC
LVETSCDQEDCFPPNVNVKVNNKLCQLPNVIPTNRPNVEPKRPPRPVNVTSNVKLSPTVT
NTITVQWCPDYTRSYCLAVYLVKKLTSTQLLQRMKTKGVKPADYTRGLIKEKLTEDADCE
IATTMLKVSLNCPLGKMKMLLPCRASTCSHLQCFDASLYLQMNERKPTWNCPVCDKPAIY
DNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSWSTPGLRSETQILDTPSKPAQKVEVISD
DIELISDDAKPVKRDLSPAQDEQPTSTSNSETVDLTLSDSDDDMPLAKRRPPAKQAVASS
TSNGSGGGQRAYTPAQQPQQSESPEQQASRQSPEKQTVSEQQLQQQQHEQPATAAVHASL
LESLAAAVADQKHFQLLDLAAVAAAAAATASSGQSQNAGP
Download sequence
Identical sequences A1Z7P5
FBpp0087651 FBpp0087651 7227.FBpp0087651 FBpp0087651 NP_724749.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]