SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088015 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088015
Domain Number 1 Region: 13-153
Classification Level Classification E-value
Superfamily L domain-like 1.07e-27
Family U2A'-like 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088015   Gene: FBgn0033210   Transcript: FBtr0088941
Sequence length 265
Comment pep:known chromosome:BDGP5:2R:3562867:3563857:-1 gene:FBgn0033210 transcript:FBtr0088941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLTPELINQSMQYINPCRERELDLRGYKIPQIENLGATLDQFDTIDLSDNDLRKLDNL
PHLPRLKCLLLNNNRILRISEGLEEAVPNLGSIILTGNNLQELSDLEPLVGFTKLETICL
LINPVSTKPNYREYMAYKFPQLRLLDFRKIKQKDRQAAQEFFRTKQGKDVLKEISRKSKM
SAAAAIAAEAGNGKGRGSEGGRLANPQDMQRIREAIKRASSLAEVERLSQILQSGQLPDK
FQHEMEAVAQNGAGHNGSGAVAMEY
Download sequence
Identical sequences Q9V4Q8
FBpp0088015 NP_610315.1.81976 7227.FBpp0088015 7304171___KOG1644 FBpp0088015 FBpp0088015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]