SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0088289 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0088289
Domain Number 1 Region: 71-520
Classification Level Classification E-value
Superfamily Sema domain 1.96e-133
Family Sema domain 0.0000395
Further Details:      
 
Domain Number 2 Region: 1389-1518,1727-1888
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.54e-43
Family p120GAP domain-like 0.034
Further Details:      
 
Domain Number 3 Region: 882-976
Classification Level Classification E-value
Superfamily E set domains 0.000000000000042
Family Other IPT/TIG domains 0.0076
Further Details:      
 
Domain Number 4 Region: 975-1063
Classification Level Classification E-value
Superfamily E set domains 0.0000000000024
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.076
Further Details:      
 
Domain Number 5 Region: 523-574
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000034
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1082-1164
Classification Level Classification E-value
Superfamily E set domains 0.0000000233
Family E-set domains of sugar-utilizing enzymes 0.056
Further Details:      
 
Weak hits

Sequence:  FBpp0088289
Domain Number - Region: 836-869
Classification Level Classification E-value
Superfamily Plexin repeat 0.000183
Family Plexin repeat 0.0043
Further Details:      
 
Domain Number - Region: 1194-1242
Classification Level Classification E-value
Superfamily E set domains 0.00042
Family E-set domains of sugar-utilizing enzymes 0.084
Further Details:      
 
Domain Number - Region: 670-706
Classification Level Classification E-value
Superfamily Plexin repeat 0.00903
Family Plexin repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0088289   Gene: FBgn0025741   Transcript: FBtr0089225
Sequence length 1945
Comment pep:known chromosome:BDGP5:4:1034030:1047654:-1 gene:FBgn0025741 transcript:FBtr0089225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFVLSVLLIAILKDKYDYWLPSRTGCQTLAANIWSDKTTAQNEPINLTNANAPIKNAKN
LNSTITNVAAFDTKLNHLLVDTITGRVFVGGVNRLYQLSPDLELSETVKTGPQNDSVECS
ILDCPLNAVRSPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIIEHEVPDAVV
ANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASS
AVTTGTRTFINSYARETYFVNYVYGFSSERFSYFLTTQLKHSHHSSPKEYITKLVRICQE
DSNYYSYTEIPVECISDAQGGTKFNLVQAGFLGKPSSDLAQSLGISIQDDVLFAVFSKGE
GNTPTNNSALCIYSLKSIRRKFMQNIKSCFNGSGMRGLDFISPSMPCVLTKLQTIGEDFC
GLDVNSPLGGETPITSVPVAMFNTKLTSVAATSTSGYTVVFVGTSDGFLKKVVIESSSIA
NEYASFAVDLGSEINRDMQFDNQNLYIYVMSKTKVSKVKVFDCSDYKTCGDCLGARDPYC
GWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLP
QLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGP
DLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPS
YRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLN
AQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCREMADSCGI
CLALSEKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLNRSEICPNPEIHTFQPKTGPWEGG
TNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYIDTKQIVCTVDSPGEQMYRNGKIVV
QIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASINDHLPCK
ILSTDSSQAICRTSASPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEHVSSGPSGQIK
VPKGIPAGGIRISVTGTQFTSIQNPNIYVVYNGEMYASPCRVQSDTEMECASPVVDVDSH
VIEAERPILLEYGFLMDNVLRVQNLSKVHNNHFELYPNPEYFIFEERVKYFKSEYLTING
RNLDRACKESDVEVKIGNGFCNITSLSRQQLTCRPPSEATATKSMNGPEVIVRIGTSLEY
RIGILSYESSNIILDWGENVIFAVIATIVILLLIFVALLVAYKKKSSESSRVLRNMQEQM
DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQWE
RPELLRKEKGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC
TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML
FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPS
HTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDV
TSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNISKYTS
SSPTFSRAGSPLNNDMHENGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTL
QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFW
VNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYR
KWVDRYYRDIRDMSPISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTL
EEDEFSQKQRLAFKLEQVHNIMSSE
Download sequence
Identical sequences Q9V491
FBpp0088287 FBpp0088290 FBpp0088287 FBpp0088290 7227.FBpp0088287 FBpp0088289 NP_524637.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]