SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0099672 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0099672
Domain Number 1 Region: 521-594,644-810
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2e-59
Family Tandem AAA-ATPase domain 0.00012
Further Details:      
 
Domain Number 2 Region: 265-519
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.51e-53
Family Tandem AAA-ATPase domain 0.0001
Further Details:      
 
Weak hits

Sequence:  FBpp0099672
Domain Number - Region: 182-227
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000545
Family ComEA-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0099672   Gene: FBgn0032157   Transcript: FBtr0100280
Sequence length 844
Comment pep:known chromosome:BDGP5:2L:9908830:9912585:-1 gene:FBgn0032157 transcript:FBtr0100280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSTVAASASASASSSAKSSLSDLRQFRINKNASSVVASPSRTERVPGKKRIQVMADSD
SDGNDSQTPKKTKLELTVKEKEERYMAAAKISPHFDTMAIQESLSRTNWDVAASVRYLRE
NCKPKGHNGPLAKSKLKPRSNGISGGNFSDNDHSDDDDVKQSKDQVYDSDDSDSEMSTKM
TGQRKKVFQFMNEASLIELQSVKTLSEKKALAIIDVRPFSDWSDLRQKLESIRMSGDLLN
YAQELINKQNTVAAILSKCNNMVSRLEKAISNGAGIVEQPKLLSSGLQLADYQIIGLNWL
TVMHKQEMNGILADEMGLGKTIQVIAFLAYLKENGLSQAAHLIVVPSSTLDNWEAEISRW
CPELVVEKYHGSQDERRRMRGRFAKDGFTGFDVLLTTYHIVGSTPEERKMFRVCKLDYVI
FDEAHMLKNMTTQRYANLITINARMRILLTGTPLQNNLLELISLLCFVMPKFFAKSIEDI
KSLFAKKGKSDGDQDEVSQFQETQIQRAKRIMKPFVLRRLKKDVLKNLPKKLSLVEKVPM
SSQQKIYYHELVDYYSNNKGEVCSSSERAGIAIMMEMRRIANHPLLMRHYFTDANLRGFS
KRLANASSFKKTNEQYIFEELAVMSDFQVYQMMNKHEFYDVKIPDNLICDSGKFLYLDTL
LPKLKAEGHRVLLFSQFTMMLDIVEEYLRIRKFGFCRLDGATAVNVRQDLITDFNGDDSI
FVFLLSTKAGGVGINLTAADTCVIHDIDFNPYNDKQAEDRCHRMGQQRPVTIYRLISEST
IEEGILMAAEEKLKLEKDITSNEKGEVHEQRCVVKLLTTALGLDKDQEEQLNNSLNNSIA
SPAK
Download sequence
Identical sequences Q9VL72
FBpp0079496 FBpp0079496 FBpp0099672 7227.FBpp0079496 NP_609320.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]