SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289844 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289844
Domain Number 1 Region: 953-1073
Classification Level Classification E-value
Superfamily Bromodomain 9.55e-22
Family Bromodomain 0.00075
Further Details:      
 
Domain Number 2 Region: 236-292
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000618
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Domain Number 3 Region: 888-948
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000132
Family PHD domain 0.0055
Further Details:      
 
Domain Number 4 Region: 82-133
Classification Level Classification E-value
Superfamily RING/U-box 0.00000883
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  FBpp0289844
Domain Number - Region: 184-227
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0671
Family B-box zinc-binding domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289844   Gene: FBgn0023097   Transcript: FBtr0300617
Sequence length 1133
Comment pep:known chromosome:BDGP5:3R:16418881:16437346:1 gene:FBgn0023097 transcript:FBtr0300617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMDLEQLKNDFLPLIAGIKQEQLDAVPTDALPQMSTPNTASGAPTTSSLSSSSLSLSNP
CDSAEKRSESNSSASAKFTLFKCVYCAQLLGSNDRPKLLECLHVACAQCVSTKFSELDRS
LPPLIHCPVCDNASQQEFIVDNQFLIEQCTAGDSGDGVGLLGLTGEGQKSSAAASIQCSS
CSDGAVATSWCVDCSEYICDSCVQAHQRLKITKDHTIKPKDEANNEQLAGAAGVDKLHMC
QLHPQEKLSLFCETCDKLTCRDCQLSDHRDHKYKFAHEIATESRQALSTLVSEINYKRFL
LSSATKVIDDRQQLIHDKKKDLIKEITAMAVKITNTVNTRGKQLIMRLNEVCDSKLKVLV
EKKETLQLLSDNTDHCIDFMQNALEKGSDFAILSSKKSLVRHLQKLKCQRADIPNPEIPV
RIQVQLNQVSDLQKVISQLGIIIVDGKPYPPTPSPNGTPQPQHPPRQPPSPNMAPPLRPG
LPPGMPAGLSPNGPPVNFGPQNGPPLYSNAAQQQFNNLSMSRSFPGDGSGKVRFGGMPPV
GMQRHGQPHVSSSTHPQNMDISLRGLLNNQAAQSPNAHMAFNGPPSYPGGPQGAPAPAHQ
PMGPQMRPHFMPGQQGFSQGGGPGGGPRDANFMNSNARFQSQYQRMANHAQQAAAAAAMA
GAAGGGGGQIPSPGALQRPQMMSNPMQNVSAMQNSLGFHGSQAGFNTGPPQTSPQLGGGG
MHSLAKWHIPQSAQQSNMCSQQGPLLPFANGRQTSENFKISLKSPNTLKNSTPPSLGGGG
AGHQGHGNGSSSAQLNAAALGLGPAVSILSNVTSTNPKTPSPSTHENTKDFTEPIDKVRD
DSINDLIATIAKLDSNGVQVLPEGRTKTTSPQVHSSTDLSNTQEVNNKNEQKDDPNEDWC
AVCLDGGELMCCDKCPKVFHQNCHIPAISSLPDESESWQCLLCVNIKELTKTEGSEKSSS
GELSALELRILQRICLELYCQYEQSLNFREPESPANTSYYEIVSSPMSLDVIRTRLDPSS
PNHYKDIAGFVSDVRLIFSNTYLFYQEDTKTYSNAKYLENFFEEQLAKWLPQFEGTKPQG
KRNTSNSPALLGVNATGSPSPIENGRKSCGSASLGDSDGACLPAKRARRSAHE
Download sequence
Identical sequences Q9VDK5
NP_524724.2.81976 FBpp0289844 7227.FBpp0083320 FBpp0083320 FBpp0083320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]