SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292538 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292538
Domain Number 1 Region: 485-612
Classification Level Classification E-value
Superfamily Second domain of FERM 5.89e-28
Family Second domain of FERM 0.00093
Further Details:      
 
Domain Number 2 Region: 239-335
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-17
Family PDZ domain 0.0089
Further Details:      
 
Domain Number 3 Region: 209-248
Classification Level Classification E-value
Superfamily WW domain 0.000000000371
Family WW domain 0.0024
Further Details:      
 
Domain Number 4 Region: 395-442
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000107
Family Ras-binding domain, RBD 0.063
Further Details:      
 
Domain Number 5 Region: 174-205
Classification Level Classification E-value
Superfamily WW domain 0.0000415
Family WW domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292538   Gene: FBgn0261859   Transcript: FBtr0303486
Sequence length 1560
Comment pep:known chromosome:BDGP5:3R:10921679:10957646:-1 gene:FBgn0261859 transcript:FBtr0303486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLLPSGRSNSDVYPLQNAANTTATSTGGATSAGGAGGAGGVGGVCGGVGATSNPKPLLL
TRTSSPQLTTLPTTNGSVVHATPTRSNGCPLTQSSGIPVTMATTATAMATATPDPSGCTE
VEGTASTELSTGLANETNCGTGIYGPLLGQSHGGVIAGMTENWPEIDGHLEAIQEKLKPG
WSVHVGKEGRLYYCNHMTQSAGWLPACEDWSKHEELSYGWERAIDSKGRSYYINHLNKTT
TYEAPECIRWDEHPPEPRQVQLQRNASLGFGFVAGSERPVIVRFVTEGGPSIGKLQPGDQ
ILAVNGEDVKDAPRDHVIQLVRACESQVNLLVCQPMAHCVLPGRKSTLLSAGKRAKLRSR
PSRVRFAESVCVNGAPLFPPSAFSLGDICVPPMANVLKVFLENGQTKSFKYDATTTVQDV
VSSLLDKLCLCCGELFSLVLEHVKSLKRNKLTLLDPQESLARIAARPGAHKLRCLFRITF
VPISAAELAQRDLHALDYLYLQCCNDVNQERFAPELQPELALRLAALHMHQHALANNFAP
AKLTVKLVEREFGLERFVPVSLFEGMKRKELRRLISHFLKLNAEMTGSSSKVLTQLQAKL
HYLDIIASLPSYGAKCFSTNQREGVERVLLVSPRFGLSQISSARNSVQPQPISAIEDFTH
VVVNREDDVTCSVSIFMLGDRAVKFIMEDRDGCEFSLVLGGYYRLLTGNVLNILREREPN
DEDNAPGFLSQHTVLPAGWSYLLPFHTRAHSVNFLMAPPYHPLVQRGQLQQQSSIQAPSS
LPYVMDLDLHSVMATELLEEAAKDSGLSDSSGSNYCEGRSHLGSHQLEAKNEQVLRRVQE
LQHLVQTSEQYLSEQEQGGGGGGVAMLEFDSDCDSLNSSKVSSTEGSQGGTILGPGAIIP
PGHPLKHSDSLTLLAETINHELSGITQGLNAIPESAPVSTSAPPTPATPKRKPSLCSTSS
PRPQRKLNGFSQLLSDLQALGTDFSQSESDSESVASPAQSPTTRRPQMMLLQAAGSSAGS
VAPAKQQLSQRSSFGLHSPDGTHFGAETKDYNLREYLQQLKEISNAASADTDVAARQLSE
IYGFEVREDTFIETDTDLIDLRAIPPPQTPDELDSLSLMNAAPPKGFEGKAEELDSFLQQ
IMVAPPTQKATPAKELTPEEIMSFIIPPPPNLEQQQVVAPVETECLYSNSVQAKREFFQS
VANGNNGTVSHSPHIIEYATVERKSKFSCCPTSKKEEQPGQEELQPPPRTPTTEQLSPPP
ARPPKSAELLQRYSPKKQVRIAASPVMQPQERRELCPPQLPPRGSPTLDGSQSSPTNAVS
GPKKPPLPPIACRPRPSNGVNSPNSSSPGSAPPAHYSPPIPATVRLPHLNQANGTLPLLP
KKPQQLHGEKLFIKNGHLIDGEALLAKTDVAMSGLLIKLDQVAAQCSVAQAAGGGTSIDE
EKFQRARNELTEQTLALVTASKFLVASMSDMTLITLPEHLTSCLTAIRRITELAQDMTRH
TSAPLQTRNIVLKVHDVASSFRELVGVEIGPIGAGQLALQAECLANVLATLLRSLRVFSP
Download sequence
Identical sequences Q9VFD3
FBpp0292538 NP_731964.2.81976 FBpp0292538 FBpp0292538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]