SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0297777 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0297777
Domain Number 1 Region: 14-333
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.79e-42
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0297777   Gene: FBgn0263025   Transcript: FBtr0306924
Sequence length 398
Comment pep:known chromosome:BDGP5:3R:23520977:23522173:1 gene:FBgn0263025 transcript:FBtr0306924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSSKLRDLILNTHVPLVLEQFPLKWECFEGSLHDWCKRFDKEATCLPAFELMALADSS
TPQWERKRTKSSQLLNMQQFLRKYGVLDGDSTHWAAYQYKKADEVPLSCRSGIGFSSFGF
PDIGNDYRFWLGSEQANTPCHYDTFGVNIVVQVHGCKSWLLFPPETPLQSTRIPYEETSV
YCLENFYAPDPAKISSYEHLGRQAYHCNLQPGNVLIVPRHWWHYVEAKSTSLSVNYWVPL
KVDMDLILDEFLVMHIVESFVRGESNQVKQYLLNPNQLDNVSTKPSDLFAQFEQAVQNLE
SGKSTRQLYDTDYISQADWKTLLNSINLSVRPLEVMPHEEYKLLLNANSKRFRVAANPPE
TTPISSNCELLVSSMCAPRVIAEMKREFFRRLGKSNSL
Download sequence
Identical sequences Q9VB06
NP_651581.2.81976 FBpp0297777 FBpp0297777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]