SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300874 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300874
Domain Number 1 Region: 52-133
Classification Level Classification E-value
Superfamily RING/U-box 2.69e-37
Family RING finger domain, C3HC4 0.00000513
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300874   Gene: FBgn0025638   Transcript: FBtr0308651
Sequence length 136
Comment pep:known chromosome:BDGP5:X:541320:542630:1 gene:FBgn0025638 transcript:FBtr0308651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVDEDGYEVPSSSSKGDKKRFEVKKVSGQQKSRVIVNECTDGNTSSFPLRRKQWNAVAL
WAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQ
VCPLDNREWDFQKYGH
Download sequence
Identical sequences B7Z114
NP_001138143.2.81976 FBpp0300874 FBpp0300874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]