SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000002357 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000002357
Domain Number 1 Region: 42-106
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000055
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000575
Family Hairy Orange domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000002357   Gene: ENSDARG00000013441   Transcript: ENSDART00000023531
Sequence length 324
Comment pep:known chromosome:Zv9:20:39614524:39622047:-1 gene:ENSDARG00000013441 transcript:ENSDART00000023531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPCEDSTSDSDMDETIDVGSENNYSGQSNGSFIRCGSPTTTSQVMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHSLAMD
FLSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSSCASQREAAAMTTSIAHHQQAL
HPHHWAAALHPIPAAFLQQSGLPSSESSSGRLSEAPQRGAALFSHSDSALRAPSTGSVAP
CVPPLSTSLLSLSATVHAAAAAAAAQTFPLSFPAGFPLFSPSVTASSVASSTVSSSVSTS
TTSQQSSGSSSKPYRPWGTEVGAF
Download sequence
Identical sequences Q9I9L0
NP_571697.2.45394 ENSDARP00000002357 ENSDARP00000002357 7955.ENSDARP00000002357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]