SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000002932 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000002932
Domain Number 1 Region: 55-136
Classification Level Classification E-value
Superfamily HMG-box 2.49e-28
Family HMG-box 0.0000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000002932   Gene: ENSDARG00000004588   Transcript: ENSDART00000026992
Sequence length 363
Comment pep:known chromosome:Zv9:19:29272129:29275079:-1 gene:ENSDARG00000004588 transcript:ENSDART00000026992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTDLAMVEQTHTSSSSSSDVLPGDSIDSGEMDLDMDASPTPGSPNSAGDKMDIAWCKTP
SGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERL
RLKHMADYPDYKYRPRKKVKSSSGKTGEKAERVSASPGAKSASKKSSKTLSRTHRKSTTL
ELTSHSVPADHHALYKSRSVSAAKQIPEKPAKRGHVYGGCSTDSSPPSVAVPASPTLSSS
AESSDPLSLYEDGLASGKEDAEPAARFKYTRAPSPTPSASHSYSSQSSSSDEEFEDELAD
PSPGFDSFSTFGTAPLDRDLEFNFESGSGSHFEFPDYCTPEVSELMISGDWLESTISNLV
FTY
Download sequence
Identical sequences Q6P0Z4
NP_998287.1.45394 ENSDARP00000002932 7955.ENSDARP00000002932 ENSDARP00000002932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]