SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000003163 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000003163
Domain Number 1 Region: 94-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.62e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 2 Region: 235-310
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.62e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000326
Further Details:      
 
Domain Number 3 Region: 8-82
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000003163   Gene: ENSDARG00000013184   Transcript: ENSDART00000025885
Sequence length 318
Comment pep:known chromosome:Zv9:9:220332:231565:1 gene:ENSDARG00000013184 transcript:ENSDART00000025885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIIT
LAGPTTAIFKAFSMIIEKLEEDISSSMSNSTATSKPPVTLRIVVPASQCGSLIGKGGCKI
KEIRESTGAQVQVAGDMLPNSTERAITIAGTPLSIIECVKQICVVMLESPPKGVTIPYRP
KPSGSPVIFAGGQAYAVQGQHAIPQPDLTKLHQLAMQQSPFPLAPSSQGFTAGMDASAQT
GSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSSDRQVTITGSPASISLA
EYLINARLSSEATGMAAN
Download sequence
Identical sequences Q7ZVK5
7955.ENSDARP00000003163 NP_957486.1.45394 ENSDARP00000003163 ENSDARP00000003163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]