SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000005849 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000005849
Domain Number - Region: 9-71
Classification Level Classification E-value
Superfamily MIT domain 0.000523
Family MIT domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000005849   Gene: ENSDARG00000002498   Transcript: ENSDART00000013930
Sequence length 164
Comment pep:novel chromosome:Zv9:10:37227637:37233092:-1 gene:ENSDARG00000002498 transcript:ENSDART00000013930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLTEICDNAKKGREYALLGNYDSSMVYYQGVIQQIHKHCQSLRDPAQKVKWQQVRQELA
EEYEQVKSIVSTLESFKVDKAVDFPNPVPEEGPRDPDVWPPPTPAEHRGPVQVKKPVPLS
KPQRKESPGMQHRGAVGRGQANIKPDRPNTRDGRGNKAKEEKSK
Download sequence
Identical sequences ENSDARP00000005849 ENSDARP00000005849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]