SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000006074 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000006074
Domain Number 1 Region: 9-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000741
Family HLH, helix-loop-helix DNA-binding domain 0.005
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000006074
Domain Number - Region: 83-111
Classification Level Classification E-value
Superfamily Orange domain-like 0.0051
Family Hairy Orange domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000006074   Gene: ENSDARG00000017917   Transcript: ENSDART00000017849
Sequence length 206
Comment pep:known chromosome:Zv9:5:71711885:71713200:1 gene:ENSDARG00000017917 transcript:ENSDART00000017849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKILAQTEKIKMDRKLLKPQVERRRRERMNRSLENLKLLLLQGPEHNQPNQRRLEKAEIL
EYTVLFLQKANKASKEEEGEEKSQFMEGFSSCLQKAARFLLEEGGLEGSVTSMLCQRLAH
PTIRLPVRGHSRKQHAESNPQHHARRPHHKNTVSKAGHPSACRNTKEPQASRAAFRSTDS
NTKHSTAQPTSRHPEPASQTVWRPWP
Download sequence
Identical sequences A3KQ57
ENSDARP00000006074 7955.ENSDARP00000006074 ENSDARP00000006074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]