SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000007566 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000007566
Domain Number 1 Region: 76-163
Classification Level Classification E-value
Superfamily HMG-box 2.23e-28
Family HMG-box 0.0000566
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily HMG-box 1.44e-25
Family HMG-box 0.0000251
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000007566
Domain Number - Region: 177-198
Classification Level Classification E-value
Superfamily ARM repeat 0.00164
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000007566   Gene: ENSDARG00000006408   Transcript: ENSDART00000024750
Sequence length 198
Comment pep:known chromosome:Zv9:21:33085576:33095593:1 gene:ENSDARG00000006408 transcript:ENSDART00000024750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGDPGKPKGKMSAYAYFVKTCREEHNKKNPGVTVNFSEFSKKCSERWKTMSPKEKTKF
EDLAKQDKARYDQEMMHYNPGKKGRKQKKDPNAPRRPPSGFFLFCAKQRPIIKAQNPSLG
IGDVAKKLGGMWNNLSDSEKQPFLSNADKLKDKYQKDMAFYRKKGSGGSSSAKSEPKDDD
EDDDEEEEDDDDDDEDDD
Download sequence
Identical sequences F1Q895
ENSDARP00000007566 7955.ENSDARP00000007566 ENSDARP00000007566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]