SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000007567 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000007567
Domain Number - Region: 56-117
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00127
Family PLC-like (P variant) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000007567   Gene: ENSDARG00000017385   Transcript: ENSDART00000008099
Sequence length 175
Comment pep:known chromosome:Zv9:21:20499408:20502845:1 gene:ENSDARG00000017385 transcript:ENSDART00000008099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELHIIGQIIGATGFPQNSLFCKWGVHTGGAWRLLSGLREGQTQVDMPQTGDMAYWSHP
IDLHYTTKGLQGWPKLHLQVWHQDSFGRCQLYGYGYIHVPSSPGQHRLQCVTWRPLGSWQ
DQLSEMFVGGGPQLRSPDLIYSGADRYRLHTVGMGTVELELCIILRHFDRYGVES
Download sequence
Identical sequences Q6DGZ1
ENSDARP00000007567 ENSDARP00000007567 GO.73238 NP_001002394.1.45394 XP_005161219.1.45394 7955.ENSDARP00000007567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]