SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000008364 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000008364
Domain Number 1 Region: 796-1009
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.46e-76
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.000000011
Further Details:      
 
Domain Number 2 Region: 661-797
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 9.55e-47
Family Domain of poly(ADP-ribose) polymerase 0.000000461
Further Details:      
 
Domain Number 3 Region: 519-642
Classification Level Classification E-value
Superfamily WGR domain-like 4.97e-40
Family WGR domain 0.00000147
Further Details:      
 
Domain Number 4 Region: 110-215
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.03e-31
Family PARP-type zinc finger 0.0045
Further Details:      
 
Domain Number 5 Region: 9-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.57e-29
Family PARP-type zinc finger 0.0054
Further Details:      
 
Domain Number 6 Region: 387-470
Classification Level Classification E-value
Superfamily BRCT domain 0.000000096
Family DNA ligase 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000008364   Gene: ENSDARG00000019529   Transcript: ENSDART00000017269
Sequence length 1013
Comment pep:known chromosome:Zv9:20:43680201:43721542:1 gene:ENSDARG00000019529 transcript:ENSDART00000017269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSQDDKLYKAEYAKSGRASCKKCKDNIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWL
RAAVQSPSDISGFTDLRWDDQEKVKTAIESGGATGGKGGQKGAAKGEKTLNDFAVEYAKS
NRSTCKGCDQKIEKDQIRVSKKTVDPEKPQLGLIDRWYHTGCFVSRREELIFKPEYSAAQ
LKGFAVLRDEDKEELKKRLPAVKSEGKRKADEVDGGVSKKQKKEDEKLEQNLKDQSQLIW
GIKDKLKKFCSINDMKELLIANSQEVPSGESNIVDRLSDCMAFGSLKPCETCKGQLVFKS
DAYYCTGDISAWTKCVFKTQTPDRKDWVTPKEFSEIPFLKKFKFKRQDRVFPKDAPPAAA
TPSSGSTTSAATSVSSASKNLTEAPADKPLTGMKLLAVGKLSKNKDDLKKFVEDLGGKIT
GTASKAALCISSKKEIEKMSKKMEEVRDAGVRVVADDFLTDIKESGKALQELISLHAISP
WGAEVKVEAPAAAAATKSTGAHSSKSTGKVKEEEGGSKSKKMKLTVKGGAAVDPDSGLEN
CAHVLEQNGKIYSATLGLVDIVRGTNSYYKLQLLEDDVQKRYWVFRSWGRVGTTIGGNKL
DKFYDKNSAMDNFCGVYEEKTGNAWASSNFTKYPNKFYPLEIDYGQDEEAVKKLTQSAGA
KSQLEKPVQDLIRMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSLLSEVQQAVA
DSSSESLILDLSNRFYTLIPHDFGMKKPPLLSNVDYIQQKVQMLDNLLDIEVAYSLLRGG
VENNEKDPIDINYEKLKTKIEVVDKSSHEAQLILQYVKNTHAATHNTYTLDVEEIFKIER
EGEYQRYRPFKELPNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMV
SKSANYCHTSQADPVGLILLGEVALGNMHELKKASHITKLPKGKHSVKGLGRSAPDPRAT
VSLNGVDIPLGKGMNTNIDDTSLLYNEYIVYDVSQVNLKYLLKIRFNYQTSLW
Download sequence
Identical sequences Q5RHR0
7955.ENSDARP00000008364 NP_001038407.1.45394 ENSDARP00000008364 ENSDARP00000008364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]