SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000008451 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000008451
Domain Number 1 Region: 20-318
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.91e-52
Family WD40-repeat 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000008451   Gene: ENSDARG00000025507   Transcript: ENSDART00000008047
Sequence length 779
Comment pep:known chromosome:Zv9:24:39143640:39163678:1 gene:ENSDARG00000025507 transcript:ENSDART00000008047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKMTRVSTINGRTMFCHLDAPANAISVCRDATQVVVAGRNIFKIYGLEEDGFVERLNLR
VGRKPSLNFSCADVMWHQMEENLLATAATNGAVVTWNLSRPCRNKQEQLFTEHKRTVNKV
CFHPTEVNMLLSGSQDGFMKCFDLRKKESVSTFSGQSESVRDVQFSMKDYFTFAASFENG
NVQLWDIRRPDRYERMFTAHTGPVFCCDWHPEDRGWLATGGRDKMVKVWDMSTNRVKEIY
CVQTIASVARVKWRPERRYHLATCSMMVDHNIYVWDVRRPFIPFATFEEHKDVTTGIVWR
HQHDPYFLLSGSKDSTLYQHMFKDASRPVDRANPEGLCFGLFGDLAFAAKESLMSAPASA
GDVGRKTYPGGDRRYPIFFFKKPDVTEQFAQVSSALSVFESEADSSAGMDWFINTAQSYL
LSGKPFAELCEHNAHVAKSLNRPQESTTWTMLRIMFSEPANPSLSTNHNLNKSGNLPLVN
SFSMKEMSGALNERNKENRQDNIHSLETNLNNNDENEETEGSEGQAEYLFVDAELDDDEL
YSMEHDNQPAEESEYLLPQEAFPLRHEIMDHPSAPEPLQEKQESPHVSGSEAESMCLTPM
ESFSLISVSQQLFSPHLPPKFFCPIVKEMLCYYAEQGDVQMAVSVLIVLGDRIRKEIDEL
MQEHWYMSYIDLLQRFELWNVSNEVIKLSTCGAIMCLNQASTTLHINCSNCKRPMSNKGW
ICDRCHQCASVCAVCHHVVKGLFVWCQGCSHGGHLEHVMEWLKQSKHCPAGCGHLCEYT
Download sequence
Identical sequences F1R418
ENSDARP00000008451 ENSDARP00000008451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]