SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000008648 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000008648
Domain Number 1 Region: 347-425
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.33e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000935
Further Details:      
 
Domain Number 2 Region: 111-199
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 3 Region: 39-113
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000264
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000008648
Domain Number - Region: 267-272
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00497
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000008648   Gene: ENSDARG00000007034   Transcript: ENSDART00000005671
Sequence length 431
Comment pep:known chromosome:Zv9:5:56981988:57000650:-1 gene:ENSDARG00000007034 transcript:ENSDART00000005671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METEIEQQDEDTTFSNTDTNGKRPAEDMDEEQAFKRSRNTDEMVELRVLLQSKNAGAVIG
KGGKNIKALRTDYNASVSVPDSSGPERILSVSADIDTIGEILLKIIPTLEEYQHYSGTDF
DCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLVGGKPERVV
ECIKVILELIAEAPIKGRAQPYDPNFYDETYDYGGFTMMYEERGRRPMGGFPMRGRGGFD
RMPPGRGSRSVPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDRFS
HQSYHSNMDDRPNDRRGRPGDRYESMSGGGYDNNSSWEPFQSGGRGSYSDIGGPVITTQV
TIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQ
NSVKQYSGRFF
Download sequence
Identical sequences B8JLJ8
NP_998156.3.45394 ENSDARP00000008648 ENSDARP00000116598 ENSDARP00000008648 7955.ENSDARP00000059789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]