SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000009095 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000009095
Domain Number 1 Region: 10-180
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-25
Family WD40-repeat 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000009095   Gene: ENSDARG00000078386   Transcript: ENSDART00000007756
Sequence length 217
Comment pep:known chromosome:Zv9:9:3242355:3255198:-1 gene:ENSDARG00000078386 transcript:ENSDART00000007756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVFKQSKSVAVTSMSFPLGDVNNFVVGSEDGSVYTASRHGSRAGISEMFEGHHGPITG
IHCHTAAGPVDFSHLFLTASFDWTVKLWSNKNNKPLYSFEDNSDYVYDVMWSPVHPALFA
CVDGLGRVDLWNLNNDTEVPTASVAVDGSPALNRLRWSQSGREIAVGDSEGQIHIYDVGE
QIAVPRNDEWTRFVRTLVEINENRDDAEELAAQRLAA
Download sequence
Identical sequences ENSDARP00000009095 ENSDARP00000009095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]