SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000009928 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000009928
Domain Number 1 Region: 177-257
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.61e-25
Family PHD domain 0.0000361
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000009928
Domain Number - Region: 12-80
Classification Level Classification E-value
Superfamily NAP-like 0.0154
Family NAP-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000009928   Gene: ENSDARG00000013042   Transcript: ENSDART00000005775
Sequence length 278
Comment pep:known chromosome:Zv9:1:40343979:40346258:-1 gene:ENSDARG00000013042 transcript:ENSDART00000005775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGHYPNVEKSQLVNYVEDYLECVESLPLDIQRNVSLLREIDTKYQEVLKEVDEIYEKYK
KESDSGQRKRLQIQLQRALISSQELGDEKIHVVTQMMEVVENRSRQIEAHSPCFLEPGDV
ERPPEKVRHDPASTSTNVMPERSSARRPRRQRNSESRDTCANGALEDLGEEPPPQPREKK
SKSAKKKKRSKAKQEREASPVEFTIDPNEPTYCLCEQVSYGEMIGCDNEQCPIEWFHFSC
VGLTYKPKGKWYCPKCRGDNEKTMEKSADRAKKDRRSR
Download sequence
Identical sequences Q6DHF1
NP_001002448.1.45394 7955.ENSDARP00000102740 ENSDARP00000009928 ENSDARP00000009928 ENSDARP00000102740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]