SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000012386 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000012386
Domain Number 1 Region: 84-182
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-24
Family Second domain of FERM 0.0027
Further Details:      
 
Domain Number 2 Region: 183-306
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-24
Family Third domain of FERM 0.0061
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.41e-20
Family First domain of FERM 0.0027
Further Details:      
 
Domain Number 4 Region: 378-428
Classification Level Classification E-value
Superfamily RING/U-box 0.00000751
Family RING finger domain, C3HC4 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000012386   Gene: ENSDARG00000008859   Transcript: ENSDART00000013497
Sequence length 472
Comment pep:known chromosome:Zv9:19:26826401:26864320:1 gene:ENSDARG00000008859 transcript:ENSDART00000013497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCHVTRPDAVVMEIEVDAKANGEDCLNKVCRKLGIIEVDYFGLQFSGSKGENLWLNLRN
RISQQMDNLTPCRLRLRVKFFVEPHLILQEQTRHLFFMHVKEDLHRGHLRMCSEQAQELS
ALLAQAEFGDYNQNTAKYWYTELCGSEPNQTTINSIIAKHKALEGLSQASVEYQALQLVS
SLEHYGVEWHWARDAEAQRLAIGVGPEGIAICRDDFSLVNRISYPIIQIATQSGKSVYLT
VTKESSDSVVLLFKLISNRAASGLYRAITETHAFYRCDTVTNAVMMQYSRDFKGHLASLF
LNENINLGKKYVFDIRRTSKEVYDYARRALYNAGIVDMMSRPGERTPSNRSPSREQEGAL
DCGGCQQSRLLQEKLQKLREALLCMLCCEEEIDAAFCPCGHMVCCQNCAAQLQSCPVCRS
EVEHVQHVYLPTCTSLLNLTIGENSPEPIHRGMAAHTCTTNDYSTSEKIYQN
Download sequence
Identical sequences Q6TEM9
7955.ENSDARP00000012386 ENSDARP00000012386 ENSDARP00000012386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]