SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000015024 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000015024
Domain Number 1 Region: 16-65
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000233
Family RING finger domain, C3HC4 0.008
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000015024
Domain Number - Region: 102-171
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0604
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000015024   Gene: ENSDARG00000009886   Transcript: ENSDART00000019667
Sequence length 221
Comment pep:known chromosome:Zv9:23:3517260:3525294:-1 gene:ENSDARG00000009886 transcript:ENSDART00000019667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMLKIDPQTDVNDAEDDDFVCPVCLEIFVRPMTTQCGHTFCNDCLQECLRPQSPVCAVC
RTDLRKWAKDDHLQDLMKRSIGKCKGCKNEVLISDMRSHTGNCFKYQNYIQEGMKSISKD
QPSIVSSVPNRSTFTCPYCKKQNFDQDGLVEHCTSKHSREAQPVVCPICASMPWGDPNYK
SADFFQHLRIRHAFSYDTFVDYTTDEQAMIQEALQRSLVEN
Download sequence
Identical sequences Q6J0N1
ENSDARP00000015024 NP_001001828.2.45394 7955.ENSDARP00000015024 ENSDARP00000015024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]