SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000015938 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000015938
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily PX domain 3.14e-22
Family PX domain 0.0026
Further Details:      
 
Domain Number 2 Region: 320-390
Classification Level Classification E-value
Superfamily MIT domain 0.0000000000000017
Family MIT domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000015938   Gene: ENSDARG00000020397   Transcript: ENSDART00000010932
Sequence length 398
Comment pep:known chromosome:Zv9:7:21112106:21123965:-1 gene:ENSDARG00000020397 transcript:ENSDART00000010932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRKTKKEEYYRFFSVTDPRTHEKGHTEYKVTARFVSKTQPENVKEVVVWKRYTELKKLH
GELAYTHRNLFRRQEEFPPFPRAQVFGRFDEAVIEERRNAAEAMLLFTTNIPALYNSPQL
KEFFRDGEVRRPLETAVISTSLPPPLIPLPERSADLLAEEETGTEAPIQAQELDSNQRLT
DLTQPEIAVEALSDTGSSPTQETQTDAEIQELTEKETEDDSTTHENNHTGQCTAATDDST
THASPEMPGSPIDQLEEFDALFDSGLEDYSFKAPPLLSDTDLAIFDPCVKEDQPYGSPSH
AELLSAPLCGSNGTDSAVDVSYVYQANEELNAAQEQEREGNYSTAVQRYRAAVDIFMKGV
QGDVDLKRRDAVKRKIAEVLEHAERLLSIQTPTHNHNT
Download sequence
Identical sequences F1QIB4
7955.ENSDARP00000015938 ENSDARP00000015938 ENSDARP00000015938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]