SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000017497 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000017497
Domain Number 1 Region: 211-503
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.24e-75
Family WD40-repeat 0.0000000000666
Further Details:      
 
Domain Number 2 Region: 97-209
Classification Level Classification E-value
Superfamily F-box domain 3.4e-25
Family F-box domain 0.00000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000017497   Gene: ENSDARG00000017230   Transcript: ENSDART00000019252
Sequence length 527
Comment pep:known chromosome:Zv9:10:21525870:21551794:1 gene:ENSDARG00000017230 transcript:ENSDART00000019252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDKTLEQMNTSVMDPQTADRSPKITLIKSTFICPQVSNGPLTGSRKRPSEGNYEKEKDV
CIQLFDQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENI
LSFLDARSLCSAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERHQWEKYLFKNR
TTEVPPNSYYRSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIIS
GLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNT
LIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKY
IVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGAC
LRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRV
FRLQFDEFQIISSSHDDTILIWDFLNVSTNGQTEGRSPSRTYTYISR
Download sequence
Identical sequences Q6PGW4
ENSDARP00000017497 7955.ENSDARP00000017497 ENSDARP00000017497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]