SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000017636 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000017636
Domain Number 1 Region: 81-135
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.06e-16
Family Tudor domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000017636   Gene: ENSDARG00000018494   Transcript: ENSDART00000028099
Sequence length 281
Comment pep:known chromosome:Zv9:5:45416927:45424192:-1 gene:ENSDARG00000018494 transcript:ENSDART00000028099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANGAEDVVFCRGTGQSDDSDIWDDTALIKAYDKAVASFKNALKGEDGATPQENDNPGKK
RKNNKKNKSRKRCNAAPDKEWQVGDSCYAFWSEDGNLYTATITSVDQEKGTCVVFYTDYG
NEEEQNLSDLLTEPPDMDEDALKTANVKETESSTEESDRSFTPQKSGHAKHKSKSNFPMG
PPSWFPSFPPGPPPPPPHFKKMDGRRGEGPGPSFPGWPPMIPLGPPMIPPPPPMSPDFGE
DDEALGSMLISWYMSGYHTGYYMGLRQGRKEAAASKKSHRK
Download sequence
Identical sequences Q9W6S8
ENSDARP00000017636 NP_571266.1.45394 ENSDARP00000017636 7955.ENSDARP00000017636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]