SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000017678 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000017678
Domain Number 1 Region: 73-205,412-564
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.37e-28
Family WD40-repeat 0.0071
Further Details:      
 
Domain Number 2 Region: 6-71,98-119
Classification Level Classification E-value
Superfamily F-box domain 5.1e-19
Family F-box domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000017678   Gene: ENSDARG00000005642   Transcript: ENSDART00000027353
Sequence length 597
Comment pep:known chromosome:Zv9:5:62966077:62989887:1 gene:ENSDARG00000005642 transcript:ENSDART00000027353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGPGLPDSLVLEIFLHLPHKAVLSAGLTCHQWFAVSRDEFLWKELFYSYYRIPRTVPR
HPAAVSWYREFKRLYDCIPCVEVQTLKEHHDQVLHLAFSHRGHRFSSCSKDCTVKLWDTE
QSDGTISLVHSCSMRQYNWGYTQFSQFNADDTLLLVSGVYLGPHHSSAGEIAVFSLDNYT
LLSRVRNKPYDVFGCWLNETHLISGNLHWIGNMTSCSVLWLNNAFQGIESENVNVVKRLF
KIQNINASTIRTVMVAHCRRHDSPDLLLDYEAQAQRTQQHQPLFFDLGNTDSEEEGEDDA
EEERGEKRLAAHLPSLKPSGLHHVLHGCQSIATRERELETKVARLMGSRRTKAPELNLVS
PSNVGEGEDMTYLLFTTGSLTYSPHQIGIKRIMPDQMTTCGPVLGEERSSEEFFDSLDHV
IDIHGHIIGMGLSPDHRYLYVNSRAWPAGCVISDPMSPPPIAEEIDLHVIDLKSLREERR
SLRAHRAFTPNDECFFIFLDVSRDFVASGAEDKHGYIWDRHYNICLARLQHDDVVNSVAF
SPADQELLLSASDDSTIKVWRSPRMVRLSQAPRPPSRAHKLLSSLLGHRSINVNGKP
Download sequence
Identical sequences Q6PFV0
ENSDARP00000017678 ENSDARP00000121908 7955.ENSDARP00000017678 ENSDARP00000017678 NP_998484.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]