SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000017792 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000017792
Domain Number 1 Region: 4-311
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.1e-54
Family WD40-repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000017792   Gene: ENSDARG00000017445   Transcript: ENSDART00000005119
Sequence length 325
Comment pep:known chromosome:Zv9:19:31067898:31078274:-1 gene:ENSDARG00000017445 transcript:ENSDART00000005119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPILLQGHERSITQIKYNREGDLLFSVAKDPIANVWYSVNGERLGTYNGHTGAVWCVDV
DWDTKNVLTGSADNSCRLWDCETGKQLALLETSSAVRTCGFDFSGNIIMFSTDKQMGYQC
FLNYYDLRDPQQIEDNQPYISVPCSESKITSAVWGPLGEFVIAGHENGEINQFSAKSGEV
LKKAKEHTKQINDIQSSVDLTMIISASKDCTAKMFDSSTLEHVKTFKTERPVNSAAISPI
MDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSY
SSGGEDGYVRIHYFDPHYFDFELEA
Download sequence
Identical sequences Q7ZV55
7955.ENSDARP00000017792 NP_998155.1.45394 ENSDARP00000017792 ENSDARP00000017792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]