SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000023168 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000023168
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.56e-66
Family N-terminal domain of xrcc1 0.00000109
Further Details:      
 
Domain Number 2 Region: 313-408
Classification Level Classification E-value
Superfamily BRCT domain 2.62e-22
Family DNA ligase 0.081
Further Details:      
 
Domain Number 3 Region: 525-615
Classification Level Classification E-value
Superfamily BRCT domain 2.33e-19
Family DNA-repair protein XRCC1 0.0000675
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000023168   Gene: ENSDARG00000009494   Transcript: ENSDART00000020033
Sequence length 617
Comment pep:known chromosome:Zv9:16:57735786:57772473:1 gene:ENSDARG00000009494 transcript:ENSDART00000020033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPELKLKHVVSCSSEDNTHKADNLLSSDTYRKWKAARPGEKQVSVILQLEKEEQIHSIDI
GNEGSAFIEVLVGHSTSVKDQDFEVLLVTSSFMSPTESRNGTNTNRVRFFGPGQLVKAQS
QEKWDRVKIVCSQPYSKTIAYGISFIKLHSPPDGNEALVSTPPKLTKLGQFRVKDESPSA
GSNVQPGALFFSRDTSAKSSTGLKVSPQNERLSYAAAALKTEGSSTHTPASDTQQAPVKR
KFEFSKERLEASGPPAKKPSSSASAETTPKAKARSSMGTSPSSRASPAQKSSDKRESPKT
KPESKPKPKPKPKSSESVPFNRILEGVVFVLSGFQNPFRADLRDKALALGARYRPDWTPD
ATHLICAFANTPKYSQVKAAGGIIVRKEWVMDCHKNKQKISCKRYLMDGAESSSESEAEQ
DESEEETPKAKTPEKKPVTPKKQQPVEEEEEEEEEYGGSTDEEGPGDDGSGMDTEDELNR
VEMASRKKKAAEQSADKGKNEDPYGGSTDENTDAEEEEDKPIPELPDFLKGKRFYLYGKF
PDNQKRLLLRYIIAFNGAVEDYMSEKVQFVITSEGWDDSFEDALMENGSLSFVKPTWIFA
INDRQKMLPYQPYTVVP
Download sequence
Identical sequences F1QXI2
ENSDARP00000023168 NP_001003988.2.45394 ENSDARP00000023168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]