SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000023480 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000023480
Domain Number 1 Region: 6-83
Classification Level Classification E-value
Superfamily HMG-box 1.11e-28
Family HMG-box 0.00000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000023480   Gene: ENSDARG00000008540   Transcript: ENSDART00000003310
Sequence length 245
Comment pep:known chromosome:Zv9:9:55102198:55103535:1 gene:ENSDARG00000008540 transcript:ENSDART00000003310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPMDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDE
AKRLRAMHMKEHPDYKYRPRRKPKTLMKKDKFAFPVAYNLGEHEALKVGGLPAGALTESL
MSNPDKAAAAAAAAAARVFFNPSMSANPYSFFDLGSKMTELSPPSFSYASPLGYPTAATA
FSGAVGGGAHTHTHSHPSPGNPGYMIPCNCAAWPSAGLQPPLAYILLPGMGKPQLEPYPA
YAAAL
Download sequence
Identical sequences Q6RVD7
ENSDARP00000023480 ENSDARP00000023480 NP_001009888.1.45394 7955.ENSDARP00000023480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]