SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000023828 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000023828
Domain Number 1 Region: 75-108
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000408
Family PHD domain 0.027
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000023828
Domain Number - Region: 274-325
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0113
Family PHD domain 0.032
Further Details:      
 
Domain Number - Region: 79-91,194-230
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0159
Family Cytochrome c3-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000023828   Gene: ENSDARG00000004046   Transcript: ENSDART00000006463
Sequence length 363
Comment pep:known chromosome:Zv9:14:32362998:32377623:1 gene:ENSDARG00000004046 transcript:ENSDART00000006463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGQRKGASARLRKCAFCRTNRDKECGQLLVAESHRVAAHHKCMLFSSALVTSHSDSENI
GGFSIEDVKKEIKRGNKLMCTSCHRPGATIGCDVKTCRRTYHYYCALWDKAQTKENPSQG
IYLVYCRKHRDASQDGSDDEQGVAANDSDSSPPRSRGRGRFEKSRIRGVSRGQSDDTRST
SSQGNDDTESSSHRDRSPLRGSPGDSGLRCGFCHAGEEENETRGVLHSDNAKKVAAHYKC
MLFSSGTVQLTTSSRAEFGNFDIKTVIQEIKRGKRMKCTLCAQLGATIGCEIKACVKTYH
YHCGLQDKAKYIENMARGIYKLYCKNHSGNEERDEEDEERESRSREKAAIDNRADPPSQV
NGN
Download sequence
Identical sequences F1QPB3
ENSDARP00000023828 7955.ENSDARP00000023828 ENSDARP00000023828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]