SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000024344 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000024344
Domain Number 1 Region: 162-270
Classification Level Classification E-value
Superfamily E set domains 2.1e-32
Family Cytoplasmic domain of inward rectifier potassium channel 0.00033
Further Details:      
 
Domain Number 2 Region: 55-175
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-19
Family Voltage-gated potassium channels 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000024344   Gene: ENSDARG00000014697   Transcript: ENSDART00000006621
Sequence length 271
Comment pep:known chromosome:Zv9:2:58822161:58829594:-1 gene:ENSDARG00000014697 transcript:ENSDART00000006621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAPQKVCHSQTQTDLLKPLLGGAGHSSHVARKRRILTKDGRSNVRIEHVSGLSALYLRDP
WTTVVDMQWRYKLVLFSATFVGTWFTFGLLWYLLALVHGDLLASAEFDPPANHSVCVMQM
QTLTGAFLFSLETQTTIGYGYRCITEECPSAIVLLIIQLLITTAMEIFITGTFVARPKKR
GETIRFSQHAVIANHDGRPSLMIRVANMRKSLLLGCQVTGKLLQPCVPKAGETVRLDQKN
VSFSVDTASESPFLILPLTFYHIIDDESPLR
Download sequence
Identical sequences ENSDARP00000024344 ENSDARP00000024344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]