SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000024476 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000024476
Domain Number 1 Region: 379-719
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.88e-40
Family WD40-repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000024476   Gene: ENSDARG00000015153   Transcript: ENSDART00000013581
Sequence length 727
Comment pep:known chromosome:Zv9:21:1910470:1933748:1 gene:ENSDARG00000015153 transcript:ENSDART00000013581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCVMASAVERTDDLVREYLIYRGFTSTLKHLDSEIKTDKEKGFRVDKIMDQLQLLIQSCD
LTGLKEYWANLERRLFCRLEDVYKPTVSKLRTSLYRFYLIHTVQVKNVEKTQEFFQKQAL
ELQAQAEWRDWFSLPFIPAPEQNPSFSAYFSRQWADTFLVSLHNFLSVLFQCMPLPALLS
FDSEVQRITSLQEDNEQLRQTVFALQGESRLKKDEQMVHHKLPPYVQHMDRLGDTELDLV
SSQRNVNMATPSRNFFSTFLPQGRRAPGRTAPGPQSSPTQSALGRKDAAASMQSSKAKDK
EVKPPSVSSMTAELSTSHPRQRRHQDHEKERKELFSKHAAQGSEKKTDSDPDTQTEAPPD
QTDSANQTRVCDVGGAGAEQPFIKLSQEEYGEHHSSIMHCRVDCSGRRVASLDVDGVVKV
WAFNPIMQTKATIMSKSPLLSLEWAAKPDRLLLLGSGVGTVKLYDTDAKKCLYEMTIDDV
HPRILSLACSPSGTSFVCSAAAHSGAVMESEPRGSAPVSGQLLLWDTKTVKQQLQFALEP
GPVAINCTAFNHNGNLLVTGAADGIIRLFDMQRYESALSWKAHDGEVYSVEFSYDENTVF
SIGEDGKFVQWNIHRCGVKQSEYSLSQDAVGPFVLSGYSGYKQVQVPRGRLFAFDSEGQH
VLTCSSTGGNIYRLNKAEAGLESVLSLAGHKAPVVTVDWCSAMDCGTCLTASMDGKIKLS
TLLAQKP
Download sequence
Identical sequences F1QCS8
ENSDARP00000024476 ENSDARP00000024476 7955.ENSDARP00000024476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]