SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000027752 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000027752
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.02e-19
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0014
Further Details:      
 
Domain Number 2 Region: 416-486
Classification Level Classification E-value
Superfamily F-box domain 0.0000000126
Family F-box domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000027752   Gene: ENSDARG00000011637   Transcript: ENSDART00000015932
Sequence length 622
Comment pep:known chromosome:Zv9:19:45359678:45381419:1 gene:ENSDARG00000011637 transcript:ENSDART00000015932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEILEAVEKLQLRLGDNQEPRKLLKTLKRLGELPMTVDILVETGIGKTVNSLRKHEYA
GEAAKNLVAKWKKLVPEKSADRPSVKDGRSHSRISESAGHRRVRERSPVEPPLMEEEQHE
EMGYQHGYSPSPPQYRHSSAPQYQSDEYESPPEDEPEPSPPPNNIRHSKPHKEPVREHNS
QDLRDQERRKQRPGGEERTNRADREQQGGTSHRSKHDRLLSSHEGKREKKGGSDGKSRER
REVPGPVDEDEEPYEAPTMSFESFLTYDAPTPTKKKKQPSRPPQPPAPLPSASSSKSSKA
NGTSSKRSKPSSSSSSVTTPAVPEKRKKVVDVVPTLPDIPLPAIQPFYRPLPSIDLTPLS
PQRRKVPVSNEEEDGGYTGRRLNSKMVVYSGSKTAYLPKMMSLYEQCIRVLQNNIDSIDE
VGGVPYEILMPVLERCTPEQLYRIEQCNQSFTEESDDLWMKHCQRDFKHAAPQEYESWRE
LYLRLHEEREERLRKLTMNISSAHANKPKLRQVKMAYVNSAVKPPRDVRRRQEKFGTKDG
SFSTSAAPPSAKIRPATNYSIQSKPSDGGQSSFSSPAPESSSRSSAPSSAAGHSARDKPQ
VKKIAPMMAKTIKAFKNRFSRR
Download sequence
Identical sequences 7955.ENSDARP00000027752 ENSDARP00000027752 ENSDARP00000027752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]