SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000028616 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000028616
Domain Number 1 Region: 90-163
Classification Level Classification E-value
Superfamily F-box domain 3.79e-16
Family F-box domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000028616   Gene: ENSDARG00000010662   Transcript: ENSDART00000036928
Sequence length 189
Comment pep:known chromosome:Zv9:18:39566755:39572608:-1 gene:ENSDARG00000010662 transcript:ENSDART00000036928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLLDEILFETAGQGPPPSKDFYQLVITRKEVIWRCWKISIRAESRGAPPGETKQFHDD
FLNDSRMQEQLAVVFGSGILEYTLALCRGHFDYLERLPDKLLLTILSYISLQDIGHLSQT
SNRFRKLCNSEEIWKKTVLGHCDGITEDMEMLAKVMGWKKIFFGFYHEKDPVSTASPAKE
EDNTNRASP
Download sequence
Identical sequences F1RC78
ENSDARP00000028616 ENSDARP00000028616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]