SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000031289 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000031289
Domain Number - Region: 74-107
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000269
Family PHD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000031289   Gene: ENSDARG00000021677   Transcript: ENSDART00000033902
Sequence length 531
Comment pep:putative chromosome:Zv9:9:30650162:30667662:1 gene:ENSDARG00000021677 transcript:ENSDART00000033902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGQSPSTYRIICALCKTSDETETTGPLSSKEDISAHQNCLLFSSNIYCKNSPTYDDLF
GFDLEDVKKEQRRGQKLRCYFCNKTGATVGCEIKRCPRSFHYPCAIKADARAIEDFSTGT
YRVYCKSHDPNPIEINDEIDNDVDLVLASVEKHVPAEQHNQSTPDPERTRPSEEVKTPAK
ASSNGGLTSDQRSCGTADKRRIECDSQEHSPEHKTPTKKKKKRRLEYPDNENPTSADAVM
APEVSAPEESMTVNQPNHSTPLPENTRSCEKLNLSTTGAAADDEDDETDIESVSLSVLNK
THLRHIEESQSVLTYETDPVPCIVILDSGPSLESEISLESCSSRNPSPAHEFVTVPKQEK
ITPTDRTSPAQTVTPQVPAPNQKRVSDGPSVSPQHPSPTAGLRISAVCTLAQSAIKKEQL
SDPPAEVSTSDSQSTVPNCQTRAAKFWTRCNQAGWSEGIFSELMSLLHSLGQRVQSGQAS
YQDYELAFEALKGSGQLPSIIAQIEKDLEKQEQDLQMKKAALCDAKAALAD
Download sequence
Identical sequences F1R115
ENSDARP00000031289 XP_021334650.1.45394 XP_697646.4.45394 ENSDARP00000031289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]