SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000034254 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000034254
Domain Number 1 Region: 480-601
Classification Level Classification E-value
Superfamily PH domain-like 2.49e-22
Family Pleckstrin-homology domain (PH domain) 0.000000826
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000034254
Domain Number - Region: 364-452
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000172
Family Synaptotagmin-like (S variant) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000034254   Gene: ENSDARG00000043661   Transcript: ENSDART00000029680
Sequence length 1316
Comment pep:known chromosome:Zv9:11:20201419:20463289:1 gene:ENSDARG00000043661 transcript:ENSDART00000029680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDPSSSEEEADEVVEEERKVVAAPKAGGPRVSSSRTSESSGGLQPSRSTNARPTSPSPS
VAVEKEKDDLEKMQREEEERKKRLQLYVFVMRCIAYPFNAKQPTDMARRQQKISKQHLQT
VKERFQAFLNGDTQIVADEAFINAVQSYYEVFLKSDRVSRMVQSGGCSANDSREVFKKHI
EKRVRSLPEIDGLSKETVLSSWIAKFDTIYRGEEDPRKHQQRMTASAASELILSKDQLYE
MFQQILGIKKFEHQLLYNACQLDNPDEQAAQIRRELDGRLQMADQFTKAGRFPKFVSRDM
EAMYIEELKSSVNLLMANLESMPVSKGGEFKLQKLKRGHNTSIIDMGQEDENQLSKSDVV
LSFTLEVVIMEVQGLKSLAPNRIVYCTMEVEGGQKLQTDQAEASKPTWGTQGDFTTTHPL
PAVKVKLFTESTGVLALEDKELGRVVLHPTPNSPKQCELHKMTVAKGCSDDLKIKLAVRM
DKPQNMKHCGYLWAIGKNLWKRWKRRFFVLVQVSQYTFAMCSYREKKAEPVELLQLDGYT
VDYTDPQPGLDGGRTFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKPVPPTQVQ
KLNAKGGTAPQLDAPISQFYADRAQKHGMDEFISANPCNFDHSSLFEMVQRLTLDHRLND
SYSCLGWFSPGQVFVLDEYCARYGVRGCHRHLCYLSDLLERAEKGSMIDPTLLHYSFAFC
ASHVHGNRPDGIGTVLVNEKEHFEEIKERLRVLLENQITHFRYCFPFGRPEGALKATLSL
LERVLMKDIVTPVPQDEVKAVIRKCLEQAALVNYQRLSEYAKVEVEKSQKDQRDPENVGR
LVTPAKKLEDTLRLAELVIEVLQQNEEHHAEGKEAFAWWSDLMVEHAETFLSLYAVDMDA
ALEVQPPDSWDSFPLFQLLNDYLRIDYNLCNGKFHKHLQDLFAPLVVRYVDLMESSIAQS
IHRGFERESWEPVKSLTSSLHSVNLPNVNLQMPKVPNLQVSVNLPPMQMPSFSTSNWIPG
LSDTDNGSGTSEDLFWKLDALQTFIRDLHWPEEEFAKHLEMRLKLMSSDMIESCVKRTRA
AFELKLQKSPRTTDFRVPQSICTMFNVMVDAKVQSAKLCAMELSQERQYHSQIDNLIEET
VKEMITLLVAKFVVILESVLAKLSRYDEGTLFSSFLSFTVKAASKYVDVPKPGMDVADSY
VTFVRHSQDVLRDKVNEEMYIERLFDQWYTSTMNLLGTWLTDRMDLQLHVYQLKILIRVV
KKKYRDFRLQGVLDSTLNSKMYETVRNRLILEEATASVREGGMQGISMKDSDEEDD
Download sequence
Identical sequences ENSDARP00000034254 ENSDARP00000034254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]