SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000035759 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000035759
Domain Number 1 Region: 271-388
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.95e-17
Family PLC-like (P variant) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000035759   Gene: ENSDARG00000023821   Transcript: ENSDART00000037193
Sequence length 669
Comment pep:known chromosome:Zv9:10:34257606:34370562:-1 gene:ENSDARG00000023821 transcript:ENSDART00000037193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSMEGVFSWVGDWQWLFMVTLFLASVVTLVVYLVLYFSNEAHDGKTHLNHVDSEEADGI
LCWVLSLKNWRSQWRRAWFRSLNEEACRSQSGIQLTFEDDGVQSSELAVDQISSFTKTRG
QKNVLCQVVGNKLQFSLSAFPSSTTSQTPLRYSVKISPLHLQLALQMKEVNGEVEISWRV
LHLDSVDLQLMPSFAQGDCQSLSDAAVTDRLRQVLNGAQASVSLSSRPAESAEVKEVRNK
TLQATSPPKPPRAHEWKLLVKNIRVTFTQEDGAAGGMNPQCILQLDDPPQKINSSVLSNK
SNPTWDQPFIFELSGRSKELNIQVVDNGKPVESGLLGQVSVPFDLVRKHPKGQQTFSLKT
KDQVTGSITTEFTYLEPNEVRTWQTPTPAPTKRVEMDRTVMPCGTVVTTVTAVRSKPGRP
LPPESKSPSKNKLAERRVSEQPSILGAKVSKALSSSDTELLILNGTDPVAEAAIRQLHES
AKQKLKSPVKKSTIIISGVSKAPLSQDEEMSLMAGYAAAMDASMSGASEGTNSDPLPPEK
VEENSIIEATESLVGANGTDHVEDWESQTGEDPDADKTSLSLCISETGSKKGKGSFLHKS
AKLFFRRRHQRKEPGMSQSHNDLQYLEHPEAAVMGDREKRTATFRRIINRKLLPKSKSKT
NGMLKEPPT
Download sequence
Identical sequences ENSDARP00000035759 ENSDARP00000035759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]