SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000037411 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000037411
Domain Number 1 Region: 87-182
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-30
Family PDZ domain 0.013
Further Details:      
 
Domain Number 2 Region: 9-64
Classification Level Classification E-value
Superfamily L27 domain 3.06e-25
Family L27 domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000037411   Gene: ENSDARG00000027322   Transcript: ENSDART00000035710
Sequence length 201
Comment pep:known chromosome:Zv9:7:33236844:33256101:-1 gene:ENSDARG00000027322 transcript:ENSDART00000035710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLGEPVRLERDISRAIELLDKLQRTGEVPPQKLQALQRVLQSEFCKAVREVYEHVYET
VDINSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYIS
RIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGTVKLVVRYTPKVLEE
MESRFEKLRSAKRRQQNNFPK
Download sequence
Identical sequences Q66IB0
ENSDARP00000037411 NP_001004672.1.45394 ENSDARP00000037411 ENSDARP00000118823 7955.ENSDARP00000037411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]