SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000038215 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000038215
Domain Number 1 Region: 72-125
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000391
Family Tudor domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000038215
Domain Number - Region: 8-42
Classification Level Classification E-value
Superfamily TPR-like 0.0974
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000038215   Gene: ENSDARG00000056235   Transcript: ENSDART00000031547
Sequence length 237
Comment pep:known chromosome:Zv9:17:20068101:20074108:1 gene:ENSDARG00000056235 transcript:ENSDART00000031547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEELMKQLSNYKAQLQQVEAALSIDPDNEDLLKLQKDLQEVIELTKDLLTSQPAEGTTS
TKSSETVAPSHSWRVGDHCMATWSQDGQVYEAEIEEIDNENGTAAITFAGYGNAEVMPLH
MLKKVEEGRIRDEIDGKPKSKKELQAEQREYKKKKAQKKVQRMKELEQEREDQKSKWQQF
NNKAYSKNKKGQVKRSIFASPESVNGKVGVGTCGIADKPMTQYNDTSKYNVRHLMPQ
Download sequence
Identical sequences B2GRC5 Q7ZV80
ENSDARP00000038215 NP_997766.1.45394 7955.ENSDARP00000038215 ENSDARP00000038215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]