SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000038728 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000038728
Domain Number 1 Region: 49-343
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-86
Family WD40-repeat 0.0000676
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000038728   Gene: ENSDARG00000023160   Transcript: ENSDART00000038230
Sequence length 347
Comment pep:known chromosome:Zv9:19:44607303:44619290:1 gene:ENSDARG00000023160 transcript:ENSDART00000038230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPKKRVADMAVVPVGVKRPRTELVAAAQSQQLSAMGPPRSSSLQAPIMLLSGHEGEVY
CCKFHPNGATLASSGYDRLILMWNVYGDCENYATLKGHSGAVMELHYNTDGSLLFSASTD
KTVCVWDSETGERVKRLKGHTSFVNSCFPARRGPQLACTGSDDGTVKLWDIRKKASVHTF
QNTYQVLSVTFNDTSDQIISGGIDNDIKVWDLRQNKLIYSMQGHGDSVTGLSLSADGSYL
LSNSMDNSVRVWDIRPFAPKERCVKIFQGNVHNFEKNLLRCSWSADGSKIAAGSADRFVY
IWDTTTRRIVYKLPGHAGSVNEVAFHPEEPIVLSGSSDKRLYIGEIQ
Download sequence
Identical sequences Q7ZTY9
ENSDARP00000038728 7955.ENSDARP00000038728 ENSDARP00000038728 NP_956616.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]