SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000038743 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000038743
Domain Number 1 Region: 12-131
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-27
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 2 Region: 148-213
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.53e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000038743   Gene: ENSDARG00000021141   Transcript: ENSDART00000032389
Sequence length 247
Comment pep:known chromosome:Zv9:16:43092391:43125622:-1 gene:ENSDARG00000021141 transcript:ENSDART00000032389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRLANSEANSKRIGVVEACFGTAGQPLAIPGRVLIGEGVLTKLCRKRPKARQFFLFND
ILVYGNIVIQKKKYNKQHIIPLESVTIDTVEDEGELRNGWLIKTPTKSFAVYAATATEKS
EWMSHINKCVSDLLEKSGKSPTGEHAAVWVPDSEATVCMRCQKMKFTPVNRRHHCRKCGF
VVCGPCSEKKFLLPSQSSKPVRVCEFCYKQLSTGATLPPRSDSYSRQGSDFGSNNISDDD
DDDDSSD
Download sequence
Identical sequences B2GRF1 Q7ZUV1
ENSDARP00000038743 ENSDARP00000038743 NP_956538.1.45394 XP_005158263.1.45394 7955.ENSDARP00000038743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]