SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000039223 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000039223
Domain Number 1 Region: 13-151
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-23
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 2 Region: 151-218
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.68e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000039223   Gene: ENSDARG00000027852   Transcript: ENSDART00000036597
Sequence length 293
Comment pep:known chromosome:Zv9:7:47585060:47586479:1 gene:ENSDARG00000027852 transcript:ENSDART00000036597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHLAFTIQNRERIQAVESSFGRTGKMLQKPGRFLVGEGCLQKLCRRGPQPRVFYLFND
ILVYGSIMLHGRWNNKQNIIPLEEVQQEDLEDGMAMANQWLIRTPRKSFYVSAESPEEKI
AWMGHIEQYRTLHVKNKGLPAKKSGDDFATPWIPDVASAICMRCSKRFTVANRRHHCRRC
GYIVCQACSKGRAVLPHISNRPVRVCRNCKNDMTDGMRQVQGKMRAKGNHWKKNSVEDTP
TMPEFENSSDEENENADECHQVPTKWFQSQEEDSFSAYCYIKPEHRNPPVGGH
Download sequence
Identical sequences Q7T3F6
ENSDARP00000039223 7955.ENSDARP00000039223 ENSDARP00000039223 NP_956634.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]