SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000039246 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000039246
Domain Number 1 Region: 63-243
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.27e-81
Family F-box associated region, FBA 0.00000805
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily F-box domain 7.72e-17
Family F-box domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000039246   Gene: ENSDARG00000012035   Transcript: ENSDART00000031527
Sequence length 247
Comment pep:known chromosome:Zv9:23:16986092:16993576:1 gene:ENSDARG00000012035 transcript:ENSDART00000031527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDVPLTVVEEILLNLPAHHVVNECRLVCPEWKELVDSAAHWRERCMREGIQPCDGSRPP
VDWCQFYFITKKRRNLIKNPVADDKFQGWEIVENGGDLWSIENSRTPLPDKTATKCFVTS
YRLCLKQQLIDLQKEGYSAAFMDHLQPHIKISDWYGPRYDCGCEYQICVELLGQNKNPIS
VFQPEKVFIQAWTDKPWYQMIHVFKNYGPGVRFIRFTHGGKDTQFWAGCYGIRVTNSSVE
ICPAAER
Download sequence
Identical sequences F1Q8M7
ENSDARP00000039246 ENSDARP00000118903 ENSDARP00000039246 XP_005162120.1.45394 7955.ENSDARP00000039246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]